DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and PLIM2a

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_182104.1 Gene:PLIM2a / 819188 AraportID:AT2G45800 Length:226 Species:Arabidopsis thaliana


Alignment Length:235 Identity:63/235 - (26%)
Similarity:89/235 - (37%) Gaps:45/235 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKG-YG 74
            ||..|.|:||..:.....|..:||:||:|..|..:|..:|.:..:..||||....:.|...| |.
plant     9 KCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKPHFEQLFKESGNYS 73

  Fly    75 FGTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPEGEGCPRCGGYVYAAEQMLARGRS 139
            ....||.....| ....|....:.|..:|.:            :.|..|...||..|::...|.|
plant    74 KNFQAGKTEKPN-DHLTRTPSKLSSFFSGTQ------------DKCATCKKTVYPLEKVTMEGES 125

  Fly   140 WHKECFKC--GTCK------KGLDSILCCEAPDKNIYCKGCYAKKFGPKG-YGY----------- 184
            :||.||:|  ..|.      ..|:.:|         |||..:.:.|..|| |.:           
plant   126 YHKTCFRCTHSGCPLTHSSYASLNGVL---------YCKVHFNQLFLEKGSYNHVHQAAANHRRS 181

  Fly   185 -GQGGGALQSDCYAHDDGAPQIRAAIDVDKIQARPGEGCP 223
             ..||.:..||.:..||.| .|..|.:.|......||..|
plant   182 ASSGGASPPSDDHKPDDTA-SIPEAKEDDAAPEAAGEEEP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 19/52 (37%)
LIM_CRP_like 120..173 CDD:188712 18/60 (30%)
LIM_CRP_like 222..275 CDD:188712 1/2 (50%)
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
PLIM2aNP_182104.1 LIM1_SF3 6..68 CDD:188824 20/58 (34%)
LIM 106..166 CDD:413332 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm966
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.