DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and WLIM2a

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_181519.1 Gene:WLIM2a / 818577 AraportID:AT2G39900 Length:200 Species:Arabidopsis thaliana


Alignment Length:182 Identity:51/182 - (28%)
Similarity:73/182 - (40%) Gaps:32/182 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKG--- 72
            ||..|.|:||..|...|.|..:||.||||..|...|..:|.:..|..:||:....:.|...|   
plant     9 KCRACEKTVYPVELLSADGISYHKACFKCSHCKSRLQLSNYSSMEGVVYCRPHFEQLFKESGSFS 73

  Fly    73 YGFGTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPEGEGCPRCGGYVYAAEQMLARG 137
            ..|.:.|..|:.....:..|....:..:.:|.:            :.|..|...||..|::....
plant    74 KNFQSPAKPLTDKPTPELNRTPSRLAGMFSGTQ------------DKCATCTKTVYPIEKVTVES 126

  Fly   138 RSWHKECFKC--GTCK------KGLDSILCCEAPDKNIYCKGCYAKKFGPKG 181
            :.:||.||||  |.|.      ..|:.||         |||..:|:.|..||
plant   127 QCYHKSCFKCSHGGCPISPSNYAALEGIL---------YCKHHFAQLFKEKG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 21/52 (40%)
LIM_CRP_like 120..173 CDD:188712 19/60 (32%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
WLIM2aNP_181519.1 LIM1_SF3 6..68 CDD:188824 22/58 (38%)
LIM2_SF3 109..169 CDD:188825 21/68 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm966
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.