DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and csrp1b

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001074083.1 Gene:csrp1b / 791132 ZFINID:ZDB-GENE-070112-252 Length:192 Species:Danio rerio


Alignment Length:183 Identity:97/183 - (53%)
Similarity:120/183 - (65%) Gaps:4/183 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75
            ||..|.|:||.|||....|..|||:||.|.:|.|:||||....|:.|:|||:|:|:|:|||||||
Zfish     8 KCGCCKKTVYFAEEVQCEGQSFHKSCFLCMVCRKNLDSTTVAVHQDEIYCKSCYGKKYGPKGYGF 72

  Fly    76 GTGAGTLSMDNGSQF-LRENGDVPSVRNGARLEPRAIARAPEG-EGCPRCGGYVYAAEQMLARGR 138
            |.||||||||.|... :|..|:. |.|......|...|:...| :.|||||..|:|||:::..|.
Zfish    73 GGGAGTLSMDGGEALGIRPAGET-SHRPTNNPNPSKFAQKLGGSDVCPRCGNAVFAAEKVVGGGN 136

  Fly   139 SWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGAL 191
            ||||.||:|..|.|.|:|....: .|..|||||||||.|||||:|:|||.|||
Zfish   137 SWHKSCFRCAKCGKSLESTTLAD-KDGEIYCKGCYAKNFGPKGFGFGQGAGAL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 27/52 (52%)
LIM_CRP_like 120..173 CDD:188712 27/52 (52%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
csrp1bNP_001074083.1 LIM 7..62 CDD:295319 28/53 (53%)
LIM2_CRP 118..171 CDD:188787 28/53 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575192
Domainoid 1 1.000 79 1.000 Domainoid score I8580
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - otm25288
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24215
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.