DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and crip2

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_012824147.1 Gene:crip2 / 780192 XenbaseID:XB-GENE-953187 Length:220 Species:Xenopus tropicalis


Alignment Length:206 Identity:76/206 - (36%)
Similarity:98/206 - (47%) Gaps:28/206 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 APKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYC-KTCHGRKFGPKG 72
            |.|||:|.|:||.||:..:.|..:||.|.||..|||:|:.....||:.:.|| |.|:...:||||
 Frog     2 ASKCPKCDKTVYFAEKVTSLGKDWHKFCLKCERCNKTLNPGGHAEHDGKPYCHKPCYAALYGPKG 66

  Fly    73 YGFGTGAGTLSMDN---------------GSQFLRENGDVP--SVRNGARLEPRAIARAPE---- 116
            ...| |||:...|.               .|...:.:|..|  |:..||:..|.|...|..    
 Frog    67 VNIG-GAGSYIYDRKPSEDKPTSPTEVQPKSDERKVSGPAPIRSLSKGAQGSPPADITASSITTF 130

  Fly   117 -GEG--CPRCGGYVYAAEQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYC-KGCYAKKF 177
             ||.  ||||...||.||::.:.|:.||:.|.:|..|.|.|......| .|...|| |.||...|
 Frog   131 TGEPNLCPRCAQKVYFAEKVTSLGKDWHRPCLRCERCSKTLTPGSHAE-HDGQPYCHKPCYGILF 194

  Fly   178 GPKGYGYGQGG 188
            ||||...|..|
 Frog   195 GPKGVNTGGVG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 24/53 (45%)
LIM_CRP_like 120..173 CDD:188712 21/53 (40%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
crip2XP_012824147.1 LIM1_TLP 5..58 CDD:188860 23/52 (44%)
LIM1_TLP 137..190 CDD:188860 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.