DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and lima1

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001072345.1 Gene:lima1 / 779798 XenbaseID:XB-GENE-987339 Length:715 Species:Xenopus tropicalis


Alignment Length:133 Identity:37/133 - (27%)
Similarity:57/133 - (42%) Gaps:30/133 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 EDQISANRPFYNPDT-----------TSIK-----ARDGEGCPRCGGAVFAAEQQLSKGKVWHKK 348
            |.|.|::.|.|:|.:           .|:|     ||  |.|..|...|:..|:..:..:|:|..
 Frog   315 EIQRSSSSPDYSPQSRVLNTMEPSPPKSVKKFQLPAR--EVCFSCQKTVYPMERLFANNQVYHNG 377

  Fly   349 CYNCADCHRPLDSVLACDGPDGDIHCRACYGKLFGPKG---FGYGHAP--------TLVSTSGES 402
            |:.|:.|...| |:.......|.::|:..:.:||..||   .|:||.|        |..|.:.||
 Frog   378 CFRCSHCSTKL-SLGTFASLHGTVYCKPHFNQLFKSKGNYDEGFGHKPHKELWVNKTETSETEES 441

  Fly   403 TIQ 405
            ..|
 Frog   442 PEQ 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788
LIM_CRP_like 120..173 CDD:188712
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712 13/52 (25%)
LIM_CRP_like 421..474 CDD:188712
lima1NP_001072345.1 LIM_Eplin_alpha_beta 354..406 CDD:188869 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.