DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and Lima1

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001107017.1 Gene:Lima1 / 65970 MGIID:1920992 Length:753 Species:Mus musculus


Alignment Length:209 Identity:53/209 - (25%)
Similarity:67/209 - (32%) Gaps:69/209 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FQPIEAPKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLD-STNCTEHERELYCKTCHGRK 67
            ||......|..|.|:||..|..||...|||.:||:|..||..|. .|..:.|.| :|||....:.
Mouse   380 FQAPAKESCVECQKTVYPMERLLANQQVFHISCFRCSYCNNKLSLGTYASLHGR-IYCKPHFNQL 443

  Fly    68 FGPKG---YGFG-------------------------------------------TGAGTLSMDN 86
            |..||   .|||                                           .|....||:.
Mouse   444 FKSKGNYDEGFGHKQHKDLWASKSDNEETLGRPAQPPNAGESPHSPGVEDAPIAKVGVLAASMEA 508

  Fly    87 GSQFLRENGDVPSVRNGARLEPRAIARAPEGEGCPRCGGYVYAAEQMLARGR-SWHKECFKCGTC 150
            .:...||..|.|     |..:...||..|..|    .||...|.|:.:...: .|..|       
Mouse   509 KASSQREREDKP-----AETKKLRIAWPPPAE----LGGSGSALEEGIKVSKPKWPPE------- 557

  Fly   151 KKGLDSILCCEAPD 164
                |.:...|||:
Mouse   558 ----DDVCKTEAPE 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 23/53 (43%)
LIM_CRP_like 120..173 CDD:188712 10/46 (22%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Lima1NP_001107017.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..186
Required for interaction with NPC1L1. /evidence=ECO:0000269|PubMed:29880681 164..166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..326
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..379
LIM_Eplin_alpha_beta 388..440 CDD:188869 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..493 0/25 (0%)
Required for interaction with MYO5B. /evidence=ECO:0000269|PubMed:29880681 491..511 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..669 21/83 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 682..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.