DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and MICAL3

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_056056.2 Gene:MICAL3 / 57553 HGNCID:24694 Length:2002 Species:Homo sapiens


Alignment Length:147 Identity:39/147 - (26%)
Similarity:51/147 - (34%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ENGDVPSVRNGARLEPRAIARAPEGEG----CPRCGGYVYAAEQMLARGRSWHKECFKCGTCKKG 153
            ||....|:  |.|.:.......|:..|    |..|...||..|::.|.|:.:|:.||||..|...
Human   735 ENAPAQSI--GIRRQGSMKKEFPQNLGGSDTCYFCQKRVYVMERLSAEGKFFHRSCFKCEYCATT 797

  Fly   154 LD-SILCCEAPDKNIYCKGCYAKKFGPKGYGYGQ-------------GGGALQSDCYAHDDGAPQ 204
            |. |....:..|...|||..|..:..    ||.|             ..|.||.......:|   
Human   798 LRLSAYAYDIEDGKFYCKPHYCYRLS----GYAQRKRPAVAPLSGKEAKGPLQDGATTDANG--- 855

  Fly   205 IRAAIDVDKIQARPGEG 221
             ||.......:..||.|
Human   856 -RANAVASSTERTPGSG 871

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788
LIM_CRP_like 120..173 CDD:188712 19/53 (36%)
LIM_CRP_like 222..275 CDD:188712 39/147 (27%)
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
MICAL3NP_056056.2 Monooxygenase domain. /evidence=ECO:0000250|UniProtKB:Q8VDP3 2..494
FAD_binding_3 87..>274 CDD:279792
NAD_binding_8 91..>119 CDD:290186
CH 524..619 CDD:278723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..706
Nuclear localization signal. /evidence=ECO:0000269|PubMed:24440334 663..684
LIM_Mical 764..818 CDD:188823 19/53 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 835..883 9/41 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 907..1313
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1335..1776
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1791..1821
DUF3585 1850..1971 CDD:288945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.