DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and mical1

DIOPT Version :10

Sequence 1:NP_477122.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001303659.2 Gene:mical1 / 568573 ZFINID:ZDB-GENE-081022-3 Length:1214 Species:Danio rerio


Alignment Length:120 Identity:34/120 - (28%)
Similarity:46/120 - (38%) Gaps:22/120 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEH--ERELYCKTCHG---RKFGPK 71
            |..|.|.:|..|...|.|..||::||.|..|..:|.....:.|  ....||: .|.   .:.|.:
Zfish   688 CYFCKKHLYVVERESAEGKFFHRSCFNCFQCGSTLRQGGYSFHSDNGRFYCE-LHSLAEEEEGDE 751

  Fly    72 GYGFGTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPEGEGCPRCGGY 126
            |:|            |:|...|||.... :||   |..|.:..|......|.|.|
Zfish   752 GHG------------GAQNHTENGSKED-KNG---ETTAASSPPAHLSIKRKGSY 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_477122.1 LIM1_MLP84B_like 11..64 CDD:188788 17/53 (32%)
LIM_CRP_like 120..173 CDD:188712 3/7 (43%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
mical1NP_001303659.2 Monooxygenase domain. /evidence=ECO:0000250|UniProtKB:Q8VDP3 1..488
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..505
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 649..676
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 747..1019 16/60 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1194..1214
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.