DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and crip1

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001153291.1 Gene:crip1 / 541319 ZFINID:ZDB-GENE-041111-1 Length:77 Species:Danio rerio


Alignment Length:75 Identity:35/75 - (46%)
Similarity:45/75 - (60%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKT-CHGRKFGPKGY 73
            ||||:|.|.||.||...:.|..:|:.|.||..|||:|.:.:..|||.:.||.. |:...|||||:
Zfish     2 PKCPKCQKEVYFAERVTSLGKDWHRPCLKCEKCNKTLSAGSHAEHEGKPYCNNPCYAALFGPKGF 66

  Fly    74 GFGTGAGTLS 83
            |.|   ||.|
Zfish    67 GRG---GTES 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 23/53 (43%)
LIM_CRP_like 120..173 CDD:188712
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
crip1NP_001153291.1 LIM_CRIP 4..57 CDD:188862 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.