DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and Crip3

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001102773.1 Gene:Crip3 / 501100 RGDID:1565018 Length:204 Species:Rattus norvegicus


Alignment Length:219 Identity:73/219 - (33%)
Similarity:92/219 - (42%) Gaps:57/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYC-KTCHGRKFGPKGYGF 75
            ||||.:.||.||:..:.|..:|:.|.||..|:..|......||....|| |.|:|..|||:|...
  Rat     5 CPRCQQPVYFAEKVSSVGKHWHRFCLKCERCHSILSPGGHAEHNGRPYCHKPCYGALFGPRGVNI 69

  Fly    76 GTGAG---------------TLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAP-------EGE 118
            | |.|               :||..|.|.        |..|.|.   |||....|       |..
  Rat    70 G-GVGCYLYNPPSPPPASSISLSPSNFSP--------PRPRTGL---PRAKKSPPYLKTFTGETS 122

  Fly   119 GCPRCGGYVYAAEQMLARGRSWHKECFKCGTCKKGL--------DSILCCEAPDKNIYCKGCYAK 175
            .||.||..||.||::::.||:||:.|.:|..|:|.|        |.:..|..|        ||..
  Rat   123 LCPGCGDPVYFAEKVMSLGRNWHRPCLRCQRCRKTLTAGSHAEHDGMPYCHIP--------CYGY 179

  Fly   176 KFGPKGYGYGQGGGALQSDCYAHD 199
            .|||||...|..|      ||.:|
  Rat   180 LFGPKGVNIGDVG------CYIYD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 20/52 (38%)
LIM_CRP_like 120..173 CDD:188712 20/60 (33%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Crip3NP_001102773.1 LIM1_TLP 5..58 CDD:188860 20/52 (38%)
LIM 124..177 CDD:295319 20/60 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.