DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and csrp3

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001307020.1 Gene:csrp3 / 450005 ZFINID:ZDB-GENE-041010-119 Length:222 Species:Danio rerio


Alignment Length:193 Identity:86/193 - (44%)
Similarity:105/193 - (54%) Gaps:29/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75
            ||..|.|:||.|||.......|||.||.|.:|.|.||||....||.|:|||||:|:|:||||||:
Zfish    38 KCAACEKTVYHAEEIQCNSRSFHKTCFICMVCRKGLDSTTVAAHESEIYCKTCYGKKYGPKGYGY 102

  Fly    76 GTGAGTLSMD--NGSQFLRENGDVPSVRNGARLEPRAIARAPEG-------------EGCPRCGG 125
            |.|||.||.|  |..:...:             ||:|...||..             :.||||..
Zfish   103 GQGAGALSSDPVNNEELQPQ-------------EPKAPRPAPANSNSSKFAQKFGSTDRCPRCSK 154

  Fly   126 YVYAAEQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGG 188
            .|||||:::..|:.|||.||:|..|.|.|:|....: .|..:|||.||||.|||||.|.|..|
Zfish   155 AVYAAEKIMGAGKPWHKTCFRCLLCGKSLESTTVTD-KDGELYCKVCYAKNFGPKGRGLGNPG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 28/52 (54%)
LIM_CRP_like 120..173 CDD:188712 24/52 (46%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
csrp3NP_001307020.1 LIM1_CRP3 38..91 CDD:188865 28/52 (54%)
LIM2_CRP3 149..202 CDD:188866 25/53 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575195
Domainoid 1 1.000 79 1.000 Domainoid score I8580
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - otm25288
orthoMCL 1 0.900 - - OOG6_104400
Panther 1 1.100 - - LDO PTHR24215
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.