DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and crip2l

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001005968.1 Gene:crip2l / 449795 ZFINID:ZDB-GENE-041010-43 Length:202 Species:Danio rerio


Alignment Length:202 Identity:76/202 - (37%)
Similarity:101/202 - (50%) Gaps:24/202 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 APKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYC-KTCHGRKFGPKG 72
            |.|||:|.|:||:||:..:.|..:||.|.||..|||:|:.....||:.:.|| |.|:...:||||
Zfish     2 ASKCPKCEKTVYSAEKVTSLGKDWHKFCLKCERCNKTLNPGGHAEHDGKPYCHKPCYAALYGPKG 66

  Fly    73 YGFGTGAGTLSMDNGSQFLRENGD--VP-SVRNGARLEPRAIARAP---------EGEG--CPRC 123
            ...| |||:...|.      ..||  || ::....:.|.:...|.|         .||.  ||||
Zfish    67 VNIG-GAGSYVYDT------PVGDDSVPVAMETKPKTEEKKATRGPVKAASFSSFSGEPNICPRC 124

  Fly   124 GGYVYAAEQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYC-KGCYAKKFGPKGYGYGQG 187
            ...||.||::.:.|:.||:.|.:|..|.|.|.:....| .|...|| |.|||..|||||...|..
Zfish   125 NKTVYFAEKVSSLGKDWHRPCLRCERCSKTLAAGSHAE-HDGQPYCHKPCYAVLFGPKGVNTGGV 188

  Fly   188 GGALQSD 194
            |..:..|
Zfish   189 GSYIYED 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 24/53 (45%)
LIM_CRP_like 120..173 CDD:188712 21/53 (40%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
crip2lNP_001005968.1 LIM1_TLP 5..58 CDD:188860 23/52 (44%)
LIM1_TLP 121..174 CDD:188860 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.