DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and csrp1

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001006881.1 Gene:csrp1 / 448688 XenbaseID:XB-GENE-941448 Length:193 Species:Xenopus tropicalis


Alignment Length:184 Identity:98/184 - (53%)
Similarity:120/184 - (65%) Gaps:6/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75
            ||..|.||||.|||....|..|||:||.|.:|.|:||||....|..|:|||:|:|:|:|||||||
 Frog     9 KCTVCQKSVYFAEEVQCEGGSFHKSCFLCMVCKKNLDSTTVAIHGEEIYCKSCYGKKYGPKGYGF 73

  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPEGEG---CPRCGGYVYAAEQMLARG 137
            |.||||||||.| :.|....|.|| |:.....|.|...|.:..|   ||||...|||||:::..|
 Frog    74 GQGAGTLSMDRG-EHLGIQTDDPS-RSQPTNNPNASKFAQKVGGTDICPRCSKSVYAAEKVIGAG 136

  Fly   138 RSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGAL 191
            .|||:.||:|..|.|||:|....:. |.:|:||.||||.|||||:|:|||.|||
 Frog   137 NSWHRTCFRCSKCGKGLESTTVADR-DGDIFCKACYAKNFGPKGFGFGQGAGAL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 28/52 (54%)
LIM_CRP_like 120..173 CDD:188712 25/52 (48%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
csrp1NP_001006881.1 LIM1_CRP1 8..63 CDD:188863 29/53 (55%)
LIM2_CRP 119..172 CDD:188787 26/53 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8277
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - otm47886
Panther 1 1.100 - - O PTHR24215
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.140

Return to query results.
Submit another query.