DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and ZK622.5

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001040831.1 Gene:ZK622.5 / 4363029 WormBaseID:WBGene00044667 Length:182 Species:Caenorhabditis elegans


Alignment Length:97 Identity:19/97 - (19%)
Similarity:35/97 - (36%) Gaps:29/97 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 DGLTEDQISAN-RPF-YNPDTTSIKARD-------GEGCPRCGGAVFAAEQQLSKGKVWHKKCYN 351
            :.:||..::|: .|. ||....|::.||       .:.|......:.:..||    ..|.::   
 Worm    87 NNITEVVLTADVAPVPYNIQKVSVRIRDNLFKLHVNQECDDEDDFITSTTQQ----TFWSRR--- 144

  Fly   352 CADCHRPLDSVLACDGPDGDIHCRACYGKLFG 383
             .||.|.            |::|...:.:..|
 Worm   145 -IDCERK------------DVYCDDRHDEFMG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788
LIM_CRP_like 120..173 CDD:188712
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712 9/52 (17%)
LIM_CRP_like 421..474 CDD:188712
ZK622.5NP_001040831.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.