DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and Crip2

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_071946.1 Gene:Crip2 / 338401 RGDID:1302959 Length:208 Species:Rattus norvegicus


Alignment Length:216 Identity:75/216 - (34%)
Similarity:100/216 - (46%) Gaps:43/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 APKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYC-KTCHGRKFGPKG 72
            |.|||:|.|:||.||:..:.|..:||.|.||..|||:|......||:.:.:| |.|:...|||||
  Rat     2 ASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCNKTLTPGGHAEHDGKPFCHKPCYATLFGPKG 66

  Fly    73 YGFGTGAGTLSMDN-GSQFLRENG--DVPSVRNGARLEPRAIARAPEGEG--------------C 120
            ...| |||:...:. .::..:..|  :||.||.    |.|..:..|:|..              |
  Rat    67 VNIG-GAGSYIYEKPPTEAPQVTGPIEVPVVRT----EERKTSGPPKGPSKASSVTTFTGEPNMC 126

  Fly   121 PRCGGYVYAAEQMLARGRSWHKECFKCGTCKKGLDSILCCEAP------DKNIYC-KGCYAKKFG 178
            |||...||.||::.:.|:.||:.|.:|..|.|.|       .|      |...|| |.||...||
  Rat   127 PRCNKRVYFAEKVTSLGKDWHRPCLRCERCSKTL-------TPGGHAEHDGQPYCHKPCYGILFG 184

  Fly   179 PKGYGYGQGGGALQSDCYAHD 199
            |||...|..|.      |.:|
  Rat   185 PKGVNTGAVGS------YIYD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 23/53 (43%)
LIM_CRP_like 120..173 CDD:188712 21/59 (36%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Crip2NP_071946.1 LIM1_TLP 5..58 CDD:188860 22/52 (42%)
LIM1_TLP 126..179 CDD:188860 21/59 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X318
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.