powered by:
Protein Alignment Mlp84B and CG33521
DIOPT Version :9
Sequence 1: | NP_001303418.1 |
Gene: | Mlp84B / 40849 |
FlyBaseID: | FBgn0014863 |
Length: | 495 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001014703.1 |
Gene: | CG33521 / 3346141 |
FlyBaseID: | FBgn0250819 |
Length: | 663 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 27/75 - (36%) |
Similarity: | 38/75 - (50%) |
Gaps: | 9/75 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 415 PKTSGGCPRCGFAVFAAEQMI----SKTRIWHKRCFYCSDCRKSL--DSTNLNDGPDGDIYCRAC 473
|:....|.:|...|:..|::| :.|.|:||.|..|.||.|.| ||.|:: ||.:||...
Fly 74 PEKVENCHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVH---DGSLYCSMH 135
Fly 474 YGRNFGPKGV 483
:...|.||.|
Fly 136 FKLIFAPKVV 145
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR24215 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.