DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mlp84B and Mical2

DIOPT Version :9

Sequence 1:	NP_001303418.1	Gene:	Mlp84B / 40849	FlyBaseID:	FBgn0014863	Length:	495	Species:	Drosophila melanogaster
Sequence 2:	NP_001180234.1	Gene:	Mical2 / 320878	MGIID:	2444947	Length:	1102	Species:	Mus musculus

Alignment Length:	71	Identity:	22/71 - (30%)
Similarity:	34/71 - (47%)	Gaps:	18/71 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 IEAPK------------CPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLD----STNCTEHE 55
            :|:|:            |..|.|.||..|...|.|:.||:.||:|.:|:.:|.    :.:|  .|
Mouse   963 LESPRKAFPLSLGGRDTCYFCKKRVYMIERLSAEGHFFHQECFRCSVCSATLRLAAYAFDC--DE 1025

  Fly    56 RELYCK 61
            .:.|||
Mouse  1026 GKFYCK 1031

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mlp84B	NP_001303418.1	LIM1_MLP84B_like	11..64	CDD:188788	20/67 (30%)
		LIM_CRP_like	120..173	CDD:188712
		LIM_CRP_like	222..275	CDD:188712
		LIM_CRP_like	325..378	CDD:188712
		LIM_CRP_like	421..474	CDD:188712
Mical2	NP_001180234.1	Monooxygenase domain. /evidence=ECO:0000250\|UniProtKB:Q8VDP3	2..494
		UbiH	87..>224	CDD:357568
		CH	522..623	CDD:366016
		Nuclear localization signal. /evidence=ECO:0000250	660..681
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	662..712
		LIM_Mical	980..1034	CDD:188823	20/54 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1700
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810