DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and rga1

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_596743.1 Gene:rga1 / 2541022 PomBaseID:SPBC3F6.05 Length:1150 Species:Schizosaccharomyces pombe


Alignment Length:221 Identity:47/221 - (21%)
Similarity:70/221 - (31%) Gaps:75/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RNGARLEPRAIARAPEGEGCPRCGGYVYAAEQMLARGRSWHKECFKCGTCK-------------- 151
            |:...:.|:|:.:....:.|..| |.|.:.:.:.|.|..:|.|||:|..|.              
pombe    97 RSDTSVFPKAVRKVSSSKICASC-GQVISGQYVRALGNIYHLECFRCHDCNSLVASKFFPIDDPT 160

  Fly   152 -------------KGLDSILCCE-----------APDKNIY-----CKGCYAKKFGPKGYGYGQG 187
                         :.|| :||..           |.:|..:     |..||. .|||....|...
pombe   161 LNKQVPLCETDYFRRLD-LLCASCGMALRGYYITALNKKFHIEHFTCSLCYT-VFGPNDSYYEYE 223

  Fly   188 GGALQSDCYAHDDGAPQIRAAIDVDKIQARPGEGCPRCGGVV---YAAEQKLSKGREWHKKC--- 246
            |...   |:.|.......|               |..|.|.:   :....:....:.||..|   
pombe   224 GKVY---CHYHYSTLFAAR---------------CCGCDGPILRQFVEVYRNGVSQNWHVPCHMI 270

  Fly   247 ---FNCKDCHKTLDSINASDGPDRDV 269
               :|.|.|.||  ||..|...|.::
pombe   271 YKFWNVKLCQKT--SIETSKKKDSEL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788
LIM_CRP_like 120..173 CDD:188712 19/95 (20%)
LIM_CRP_like 222..275 CDD:188712 15/57 (26%)
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
rga1NP_596743.1 LIM1_Lrg1p_like 116..172 CDD:188777 12/56 (21%)
LIM2_Lrg1p_like 180..232 CDD:188778 12/55 (22%)
LIM 485..539 CDD:295319
RhoGAP_fLRG1 835..1044 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24215
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.