DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlp84B and mlp-1

DIOPT Version :9

Sequence 1:NP_001303418.1 Gene:Mlp84B / 40849 FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001367782.1 Gene:mlp-1 / 175847 WormBaseID:WBGene00003375 Length:115 Species:Caenorhabditis elegans


Alignment Length:90 Identity:61/90 - (67%)
Similarity:73/90 - (81%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSFQPIEAPKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHG 65
            || |:|:|.||||:||||||||||..||||.:||.||||.||||.|||.:|.||:.:|:||.||.
 Worm     1 MP-FKPVEHPKCPKCGKSVYAAEEMSAGGYKWHKFCFKCSMCNKLLDSMSCCEHQAQLFCKQCHC 64

  Fly    66 RKFGPKGYGFGTGAGTLSMDNGSQF 90
            |::||||.|||.|||:|:||.|.||
 Worm    65 RRYGPKGIGFGIGAGSLTMDTGEQF 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 36/52 (69%)
LIM_CRP_like 120..173 CDD:188712
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
mlp-1NP_001367782.1 LIM1_MLP84B_like 10..63 CDD:188788 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158560
Domainoid 1 1.000 99 1.000 Domainoid score I4453
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H111061
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1214165at2759
OrthoFinder 1 1.000 - - FOG0000284
OrthoInspector 1 1.000 - - oto18784
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4662
SonicParanoid 1 1.000 - - X318
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.