DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Mlp84B and Mical1

DIOPT Version :9

Sequence 1:	NP_001303418.1	Gene:	Mlp84B / 40849	FlyBaseID:	FBgn0014863	Length:	495	Species:	Drosophila melanogaster
Sequence 2:	XP_006512633.1	Gene:	Mical1 / 171580	MGIID:	2385847	Length:	1207	Species:	Mus musculus

Alignment Length:	112	Identity:	28/112 - (25%)
Similarity:	35/112 - (31%)	Gaps:	34/112 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    96 DVPSVRNGARLEPRAIARAPE---------GEGCPRCGGYVYAAEQMLARGRSWHKECFKCGTCK 151
            :.||.......||......||         .|.|..||.::|..|:....|..:|:.||.|.||:
Mouse   809 ETPSTEEPPVSEPSMSPNTPELSEHQEAGAEELCELCGKHLYILERFCVDGHFFHRSCFCCHTCE 873

  Fly   152 KGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGALQSDCYAH 198
            ..|                       .|.|||...|.|...  |..|
Mouse   874 ATL-----------------------WPGGYGQHPGDGHFY--CLQH 895

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Mlp84B	NP_001303418.1	LIM1_MLP84B_like	11..64	CDD:188788
		LIM_CRP_like	120..173	CDD:188712	13/52 (25%)
		LIM_CRP_like	222..275	CDD:188712
		LIM_CRP_like	325..378	CDD:188712
		LIM_CRP_like	421..474	CDD:188712
Mical1	XP_006512633.1	FAD_binding_3	244..>281	CDD:366675
		CH	670..770	CDD:366016
		LIM_Mical_like	842..895	CDD:188744	20/77 (26%)
		DUF3585	1077..1205	CDD:371910
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1700
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810