powered by:
Protein Alignment Mlp84B and Crip1
DIOPT Version :9
Sequence 1: | NP_001303418.1 |
Gene: | Mlp84B / 40849 |
FlyBaseID: | FBgn0014863 |
Length: | 495 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_031789.1 |
Gene: | Crip1 / 12925 |
MGIID: | 88501 |
Length: | 77 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 32/68 - (47%) |
Similarity: | 40/68 - (58%) |
Gaps: | 1/68 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 PKCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCK-TCHGRKFGPKGY 73
||||:|.|.||.||...:.|..:|:.|.||..|.|:|.|....|||.:.||. .|:...|||||:
Mouse 2 PKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAMFGPKGF 66
Fly 74 GFG 76
|.|
Mouse 67 GRG 69
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1700 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1214165at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000284 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.