DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub84B and TUB2

DIOPT Version :9

Sequence 1:NP_476772.1 Gene:alphaTub84B / 40848 FlyBaseID:FBgn0003884 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_116616.1 Gene:TUB2 / 850506 SGDID:S000001857 Length:457 Species:Saccharomyces cerevisiae


Alignment Length:438 Identity:180/438 - (41%)
Similarity:263/438 - (60%) Gaps:18/438 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDD----SFNTFFSETGAGKH 61
            |||.|.|..||.|.|||.|.||..|.|||:..:|      |..|.||    ..|.:|:|..:||.
Yeast     1 MREIIHISTGQCGNQIGAAFWETICGEHGLDFNG------TYHGHDDIQKERLNVYFNEASSGKW 59

  Fly    62 VPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLA 126
            |||::.|||||..:|.||......||.|:..|.|:..|.|.:|:||||.|.|:||.|:|.||:.|
Yeast    60 VPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREA 124

  Fly   127 DQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTT 191
            :.|..||||.|.||.|||||||..:||:.::..::..:....|::.|:|:.|..||||||:.|:.
Yeast   125 EGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSV 189

  Fly   192 HTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQ 256
            |..:||||..|.:||||:||||:|.|.:.:|:|.:||.|:..::|.:|.|||:.|.||.||.:..
Yeast   190 HQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLA 254

  Fly   257 TNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRG 321
            .||||:||:||.:|.|||:.:........|:|.|:|...|:..|.|...|||:|:|:.....:||
Yeast   255 VNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRG 319

  Fly   322 DVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAE 386
            .|..|:|...:..:::|.:..||:|.|...:..:    .:|.|.|    :..|...::|:|:|.|
Yeast   320 KVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAV----CSVAPQG----LDMAATFIANSTSIQE 376

  Fly   387 AWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEE 434
            .:.|:..:|..|:.::||:|||..|||:|.|||||..::..|..:|::
Yeast   377 LFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub84BNP_476772.1 PTZ00335 1..439 CDD:185562 180/438 (41%)
TUB2NP_116616.1 beta_tubulin 2..426 CDD:276956 179/437 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.