DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub84B and TUBG2

DIOPT Version :9

Sequence 1:NP_476772.1 Gene:alphaTub84B / 40848 FlyBaseID:FBgn0003884 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_024306462.1 Gene:TUBG2 / 27175 HGNCID:12419 Length:596 Species:Homo sapiens


Alignment Length:299 Identity:105/299 - (35%)
Similarity:171/299 - (57%) Gaps:16/299 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAV 66
            ||.|::.:||.|.|||...|:..|.||||.|:|.:....|  .|.|..:.||.:.....::||||
Human     3 REIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFAT--EGTDRKDVFFYQADDEHYIPRAV 65

  Fly    67 FVDLEPTVVDEVRTGTYRQLFHPEQLITGKE--DAANNYARGHYTIGKEIVDLVLDRIRKLADQC 129
            .:||||.|:..:....|.:|::||.:...:.  .|.||:|.| ::.|::|.:.:.|.|.:.||..
Human    66 LLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG-FSQGEKIHEDIFDIIDREADGS 129

  Fly   130 TGLQ---------GFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYP-APQVSTAVVEP 184
            ..|:         ||::.||..||||||..|.|:|||:..|.||....::::| ..::|..||:|
Human   130 DSLELQNSSRVIKGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQP 194

  Fly   185 YNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN 249
            |||:||.....:::||..::||.|:..|....|.|:.|:::.:|:|:..|:|:.|.:||:.|.:|
Human   195 YNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMN 259

  Fly   250 VDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSV 288
            .||.....:|:|.||:||.:..|.| ::.:::.....||
Human   260 NDLIGLIASLIPTPRLHFLMTGYTP-LTTDQSVRAAFSV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub84BNP_476772.1 PTZ00335 1..439 CDD:185562 105/299 (35%)
TUBG2XP_024306462.1 gamma_tubulin 3..>293 CDD:276957 103/293 (35%)
INTAP 306..>379 CDD:318758
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.