DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and AT3G45760

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_190162.4 Gene:AT3G45760 / 823719 AraportID:AT3G45760 Length:474 Species:Arabidopsis thaliana


Alignment Length:224 Identity:59/224 - (26%)
Similarity:96/224 - (42%) Gaps:45/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 SSDLDLFVDIGKSGNTFHTFEHRASNATVAKLRAMRKFFCDSEDWRLINFIE------QARVPII 334
            ||..||.|.|..|..|...:..:       ||..:.:|...........|:.      .|||||:
plant   101 SSQKDLDVSINFSSGTSEFYREK-------KLEILTRFATKLRSLEGQGFVRNVVPILSARVPIV 158

  Fly   335 KTCHLPTGIECDICLNSM-GFCNTNLLKYIFESQPLTQYMCIYVKNWLERCKLT----EQISTYS 394
            :.|...||||||:.:.|. |...:.:::.|.:.....|.:|:.:|:|.....:.    ..:::.|
plant   159 RFCDQGTGIECDLTVESKDGILTSQIIRIISQIDDRFQKLCLLIKHWARAHGVNNASHNTLNSIS 223

  Fly   395 ITLMVIYFLQLQA--LLPPIAMLQIEDAANQAVLVGPWVV--------NFAQKSFSELGLQQLKA 449
            ||::|.:.||.|:  :|||.:.| .:|.      :.|.:|        |:.|::...||  :|.|
plant   224 ITMLVAHHLQTQSPPILPPFSTL-FKDG------IDPPIVEKRTQKFLNWGQRNQESLG--RLFA 279

  Fly   450 T--------VPVIKGFLRNFFAYFAKFDY 470
            |        ..|.:.|.|.|..|.|:..|
plant   280 TFFIKVEDFTDVARNFARVFSDYGAEKIY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 26/94 (28%)
AT3G45760NP_190162.4 NT_PAP_TUTase 64..181 CDD:143392 26/86 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2478
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12271
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.920

Return to query results.
Submit another query.