DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and MTPAP

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_060579.3 Gene:MTPAP / 55149 HGNCID:25532 Length:582 Species:Homo sapiens


Alignment Length:408 Identity:92/408 - (22%)
Similarity:177/408 - (43%) Gaps:90/408 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 KKQAQVKARQHITVRLPKKARAMIVGEITNVFKDKYPIADKLK-VIPEYDVIEQD------LCKL 250
            |.|...::|...:.:||:..:     ::..:......|.|:|. ::.|:.:.|::      .|.|
Human   154 KNQTSERSRVRSSNQLPRSNK-----QLFELLCYAESIDDQLNTLLKEFQLTEENTKLRYLTCSL 213

  Fly   251 L----SPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGK---------SGNTFHTF------- 295
            :    :..||...:|  .|||.:...|....|||:|:|:.:         |||....|       
Human   214 IEDMAAAYFPDCIVR--PFGSSVNTFGKLGCDLDMFLDLDETRNLSAHKISGNFLMEFQVKNVPS 276

  Fly   296 EHRASNATVAKLRAMRKFF---CDSEDWRLINFIEQARVPIIKTCHLPTGIECDICLNSMGFCNT 357
            |..|:...::.|......|   |..     :..|..||.|:::..|..:|.:||:..|:.....:
Human   277 ERIATQKILSVLGECLDHFGPGCVG-----VQKILNARCPLVRFSHQASGFQCDLTTNNRIALTS 336

  Fly   358 NLLKYIFES-QPLTQYMCIYVKNWLERCKLTEQ-----ISTYSITLMVIYFLQLQALLPPI---- 412
            :.|.||:.: ....:.:...|:.|.....||..     |:.:|:|:|||:|||.::  |||    
Human   337 SELLYIYGALDSRVRALVFSVRCWARAHSLTSSIPGAWITNFSLTMMVIFFLQRRS--PPILPTL 399

  Fly   413 -AMLQIEDAANQAVLVG---PWVVNFAQKSFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYEHF 473
             ::..:.||.::.|:.|   .:|     :..|.:...|...|:.::   |:.||.||..|.::. 
Human   400 DSLKTLADAEDKCVIEGNNCTFV-----RDLSRIKPSQNTETLELL---LKEFFEYFGNFAFDK- 455

  Fly   474 LVCPYIGQANVEIAKIERMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHNVTKAVTKYGLQT 538
                  ...|:...:.:            :.|:.|     |:.:|:|.:.:.|::|.|::..||.
Human   456 ------NSINIRQGREQ------------NKPDSS-----PLYIQNPFETSLNISKNVSQSQLQK 497

  Fly   539 FVDYCQQTAELLEEPSTN 556
            |||..:::|.:|::..|:
Human   498 FVDLARESAWILQQEDTD 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 34/147 (23%)
MTPAPNP_060579.3 NT_PAP_TUTase 206..344 CDD:143392 35/144 (24%)
PAP_assoc 440..483 CDD:281779 12/69 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1188122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.