DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and Trf4-2

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001262941.1 Gene:Trf4-2 / 42983 FlyBaseID:FBgn0039251 Length:407 Species:Drosophila melanogaster


Alignment Length:308 Identity:67/308 - (21%)
Similarity:123/308 - (39%) Gaps:84/308 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 FGSRITGIGNRSSDLDLFVDIGKSGNTFHTF-----EHRASNATVAKLRAMRKFFCDSEDWRLIN 324
            |||..||:....||:||.|        ::.|     .|...|..|::         ...|...:.
  Fly    72 FGSFRTGLNLPDSDIDLVV--------YYKFWNPRLLHELQNELVSQ---------GVTDPDTVT 119

  Fly   325 FIEQARVPIIKTCHLPTGIECDICLNSM--GFCNTNLLKYIFESQPLTQYMCIYVKNWLERCKLT 387
            .:::|.||::|...|.:.|..|:..||:  |....:|:|......|....:.:.:|.:|......
  Fly   120 VLDKASVPVVKFTDLISRIRFDVTFNSVASGVQAADLIKDFIRHFPELPKLVMVLKQFLSLHGFN 184

  Fly   388 E-----QISTYSITLMVIYFLQLQALLPPIAMLQIEDAANQAVLVGPWVVNFAQKSFSELGLQQL 447
            |     .:|:|::|||||.|||..|            .:|:.:           ...|:|.|   
  Fly   185 EVYNSGGVSSYALTLMVISFLQQHA------------RSNRRL-----------SEHSKLAL--- 223

  Fly   448 KATVPVIKGFLRNFFAYFA-KFDYEHFLVCPYIGQANVEIAKIERMLHARYSAYVSDNPECSIQL 511
                     .|..|..|:. |||:..:.: ..:||...    :|:   ||..:.:.:|...|:  
  Fly   224 ---------LLIQFLDYYGRKFDFFKYGI-SVLGQGGC----VEK---ARLRSTLGENNWQSV-- 269

  Fly   512 KKPMVVQDPIQLNHNVTKAVTKYG----LQTFVDYCQQTAELLEEPST 555
               :.::||:...:::.:  :.||    :|.|.....:.::|::..|:
  Fly   270 ---LCIEDPVTPTNDIGR--SSYGVLGVMQGFGAAFVKLSKLVDSDSS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 27/105 (26%)
Trf4-2NP_001262941.1 NT_PAP_TUTase 52..161 CDD:143392 27/105 (26%)
PAP_assoc 221..280 CDD:281779 17/83 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.