DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and Gld2

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001262829.1 Gene:Gld2 / 42602 FlyBaseID:FBgn0038934 Length:1364 Species:Drosophila melanogaster


Alignment Length:465 Identity:98/465 - (21%)
Similarity:170/465 - (36%) Gaps:135/465 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 QPQELQTIKRTFSCS---SCSNRIVGTTIAKAVAHLSEQHPKPNPNNQPVQPHPTHQ-------- 188
            ||..: ::....|||   |.|..::....:|:...:.|::     |:....|...|.        
  Fly   846 QPDNI-SVASNLSCSPSASSSKSVLAPMASKSNITMPEEN-----NDDDELPLVVHNRYWREFFG 904

  Fly   189 -TKQEKKQAQVKARQHITVRLPKKARAMIVG--------------------EITNVFKDK----- 227
             |..::...:.|   .:.:|.|.|    ::|                    :..:|:|.|     
  Fly   905 YTPADRFLLRAK---FVEMRRPPK----VMGCKNKWDPLSLSVWKKFLESQQTRHVYKIKMRLWR 962

  Fly   228 --YPIADKLKVIPEYDVIEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKSGN 290
              |.:|  :|..|.|.                    :|..||.|:..|::.||:|:.:....:.|
  Fly   963 AIYTVA--MKNYPRYG--------------------LYLVGSSISYFGSKCSDMDICMLACTNPN 1005

  Fly   291 TFHTFEHRASNATVAKLRAMRKFFCDSEDWRLINFIEQARVPIIK---TCHLPTGIECDICL-NS 351
            .....|      .|..|..|::....:..::..|.|| |||||::   .||   .:|.||.. ||
  Fly  1006 IDSRME------AVYHLHVMKELLGRTNMFQDFNLIE-ARVPILRFTDRCH---KVEVDINFNNS 1060

  Fly   352 MGFCNTNLLKYIFESQPLTQYMCIYVKNWLERCKLTE----QISTYSITLMVIYFLQLQALLPPI 412
            :|..||:||....:.....:.|.:.||.|.:...:..    .||:||:.||||:|||:.| .||:
  Fly  1061 VGIRNTHLLYCYSQLDWRVRPMALTVKQWAQYHNINNAKNMTISSYSLMLMVIHFLQVGA-SPPV 1124

  Fly   413 ------------AMLQIEDAANQAVLVGPWVVNFAQKSFSELGLQQLKATVPVIKGFLRNFFAYF 465
                        .:||..|              |.....:|:...........:...|.:|..|:
  Fly  1125 LPCLHNLYPEKFGLLQPND--------------FGYVDMNEVMAPYQSDNSQTLGDLLLSFLHYY 1175

  Fly   466 AKFDYEHFLVCPYIGQA-NVEIAKIERMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHNVTK 529
            :.|||..:.:...:|.. .:|:.:            .:..|:..|.....:.:::|.. ..|..:
  Fly  1176 SVFDYGKYAISIRVGGVLPIEVCR------------AATAPKNDIHQWNELCIEEPFD-QTNTAR 1227

  Fly   530 AVTKYGLQTF 539
            :|  |...||
  Fly  1228 SV--YDTDTF 1235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 33/122 (27%)
Gld2NP_001262829.1 NT_PAP_TUTase 954..1073 CDD:143392 40/150 (27%)
PAP_assoc 1163..1224 CDD:281779 11/73 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.