DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and Tut4

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_038965897.1 Gene:Tut4 / 313481 RGDID:1310138 Length:1652 Species:Rattus norvegicus


Alignment Length:329 Identity:84/329 - (25%)
Similarity:140/329 - (42%) Gaps:83/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 EYDVIEQDLCKLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKSGNTFHTFE-HRASNA 302
            |||                :..|:..|||...|.|.|.||||:.:          |.| |..:..
  Rat  1005 EYD----------------EKARLCLFGSSKNGFGFRDSDLDICM----------TLEGHENAEK 1043

  Fly   303 TVAK--LRAMRKFFCDSEDWRLINFIEQARVPIIKTCHLPTGIECDICL-NSMGFCNTNLLKYIF 364
            ...|  :..:.|........|.|..|..|:|||:|..|..:|:|.||.| |::...||.:|....
  Rat  1044 LNCKEIIENLAKILKRHPGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYA 1108

  Fly   365 ESQPLTQYMCIYVKNWLERCKLTE----QISTYSITLMVIYFLQLQALLPPIAMLQ-IEDAAN-- 422
            ...|..||:...:|.:.:||.:.:    .:|:|:..|||:|||| |...|.|.:|| |.|...  
  Rat  1109 AIDPRVQYLGYTMKVFAKRCDIGDASRGSLSSYAYILMVLYFLQ-QRKPPVIPVLQEIFDGKQIP 1172

  Fly   423 QAVLVGPWVVNFAQKSFSELGLQQLKATVPVI-----------KGFLRNFFAYFAKFDYEHFLVC 476
            |.::.| |...|..|:      ::||..:|.:           .|.||   .|..:||::.::: 
  Rat  1173 QRMVDG-WNAFFFDKT------EELKKRLPSLGKNTESLGELWLGLLR---FYTEEFDFKEYVI- 1226

  Fly   477 PYIGQANVEIAKIERMLHARYSAYVSDNPECSIQLKKPMVVQDPIQLNHN----VTKAVTKYGLQ 537
                  ::...|:......::::             |.:.::||..||||    |::.:|.:.::
  Rat  1227 ------SIRQKKLLTTFEKQWTS-------------KCIAIEDPFDLNHNLGAGVSRKMTNFIMK 1272

  Fly   538 TFVD 541
            .|::
  Rat  1273 AFIN 1276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 34/122 (28%)
Tut4XP_038965897.1 TUTase 287..618 CDD:408858
PAP_assoc 650..699 CDD:397761
TRF4 948..>1280 CDD:227585 84/329 (26%)
NT_PAP_TUTase 990..1108 CDD:143392 37/128 (29%)
AIR1 <1295..>1384 CDD:227414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.