DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and MTPAP

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster


Alignment Length:350 Identity:87/350 - (24%)
Similarity:133/350 - (38%) Gaps:106/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PGFPKQPLRVYKFGSRITGIGNRSSDLDLFV----DIG---------KSGNTFHTFEHRASNATV 304
            |....||     |||.:.|.|....||||.:    |:|         .|...:||.|    |.:.
  Fly   210 PAAQAQP-----FGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTKE----NLSN 265

  Fly   305 AKLRAMRKFFCDSEDWRL-------INFIEQARVPIIKTCHLPTGIECDICLNSM-GFCNTNLLK 361
            .:.:..|...|..:...|       :..|.||||||||..|....:|.|:.:::: ||..:.||.
  Fly   266 GRSQTQRHMECFGDMLHLFLPGVCHVRRILQARVPIIKYHHEHLDLEVDLSMSNLTGFYMSELLY 330

  Fly   362 YIFESQPLTQYMCIYVKNWLERCKLTEQ-----ISTYSITLMVIYFLQ--LQALLPPIAMLQ--- 416
            ...|..|..:.:...::.|.:.|.||..     ||.:|:|.:|::|||  .|.:||.|..|.   
  Fly   331 MFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQLRQPILPTIGALAKAA 395

  Fly   417 -------IEDAANQAVLVGPWVVNFA---QKSFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYE 471
                   .||..|.........:.|.   |.|.|||.||               ||.::::||: 
  Fly   396 EPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELLLQ---------------FFEFYSQFDF- 444

  Fly   472 HFLVCPYIGQANVEIAKIERMLHARYSAYVSDNPECSIQLKKP----MVVQDPIQLNHNVTKAVT 532
                                  |.|..:.....|     |.||    |.:.:|::...||:|.|:
  Fly   445 ----------------------HNRAISLNEGKP-----LSKPDHSAMYIVNPLEQLLNVSKNVS 482

  Fly   533 KYGLQTFVDYCQQTAELLEEPSTNW 557
                   ::.|::..  :|..:..|
  Fly   483 -------LEECERLR--IEVRNAAW 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 38/131 (29%)
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 38/131 (29%)
PAP_assoc 427..477 CDD:281779 18/92 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1188122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.