DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and Tent4b

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001359262.1 Gene:Tent4b / 214627 MGIID:1917820 Length:700 Species:Mus musculus


Alignment Length:426 Identity:96/426 - (22%)
Similarity:144/426 - (33%) Gaps:155/426 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 KKARAMIVGEITNVFKDKYPIADKLKVIPEYDVIEQDLCKLLSPGFPKQPLRVYKFGSRITGIGN 274
            :|.|..:|..|.:|.|:.:|.||                             |..|||..||:..
Mouse   219 EKMRMEVVSRIESVIKELWPSAD-----------------------------VQIFGSFKTGLYL 254

  Fly   275 RSSDLDLFVDIGKSGN-TFHTFEHRASNATVAKLRAMRKFFCDSEDWRLINFIEQARVPIIKTCH 338
            .:||:||.| .||..| ...|.|           .|:||.....||  .:..:::|.|||||...
Mouse   255 PTSDIDLVV-FGKWENLPLWTLE-----------EALRKHKVADED--SVKVLDKATVPIIKLTD 305

  Fly   339 LPTGIECDICLN-SMGFCNTNLLKYIFESQPLTQYMCIYVKNWLERCKLTE----QISTYSITLM 398
            ..|.::.||..| ..|....:|:|...:..|:..|:.:.:|.:|.:..|.|    .|.:||:.||
Mouse   306 SFTEVKVDISFNVQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTGGIGSYSLFLM 370

  Fly   399 VIYFLQL----QALLPPI----------------------------------------------- 412
            .:.||||    .|.:|..                                               
Mouse   371 AVSFLQLHPREDACIPNTNYGVLLIEFFELYGRHFNYLKTGIRIKDGGSYVAKDEVQKNMLDGYR 435

  Fly   413 -AMLQIEDAANQAVLVGPWVVNFAQKSFSELGLQQLKATVPVIKGFLRNFFAYFAKFDYEHFL-- 474
             :||.|||.......||.          |..|..|:|..                 |||.:.:  
Mouse   436 PSMLYIEDPLQPGNDVGR----------SSYGAMQVKQA-----------------FDYAYVVLS 473

  Fly   475 -----VCPYIGQANVE--IAKIERMLH--ARYSAYVS------DNPECSIQLKKPMVVQDPIQL- 523
                 :..|......|  :.:|.|:..  |.|..::|      :.||.|.......::.|..|| 
Mouse   474 HAVSPIAKYYPNNETESILGRIIRVTDEVATYRDWISKQWGLQNRPEPSCNGNGVTLIVDTQQLD 538

  Fly   524 --NHNVTKAVTKYGLQTFVDYCQQTA-ELLEEPSTN 556
              |:|:::.....|      .|:..| |.|.:.|:|
Mouse   539 KCNNNLSEEKEALG------KCRSNASEPLSKHSSN 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 34/120 (28%)
Tent4bNP_001359262.1 TRF4 201..>473 CDD:227585 74/323 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.