DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and T08B2.4

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_491797.1 Gene:T08B2.4 / 188273 WormBaseID:WBGene00020345 Length:119 Species:Caenorhabditis elegans


Alignment Length:119 Identity:21/119 - (17%)
Similarity:48/119 - (40%) Gaps:19/119 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MEAHFFLQTLNSVNQTTNPPQLDPHLANLLE-RIMVGIESYLDRNPTYVLPQEMAAPGEGVAFVQ 135
            |..|:..|...::..|.:|.:.|.:||..:: .:...|:|.::.:......:.|.:.......:|
 Worm     1 MLIHYLQQVELTLVLTNDPFEADHYLAQRVDLSVYEYIQSCMEHSKKVFTDRRMRSESSPTTHLQ 65

  Fly   136 PQELQTI------------------KRTFSCSSCSNRIVGTTIAKAVAHLSEQH 171
            |..:..:                  |:.:|.:....:|....:||:|.:|:.|:
 Worm    66 PHRIMVLSRNRYESIGLRGKFFKNQKKCYSKNCNHKKISEAFLAKSVTNLAYQY 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551 11/54 (20%)
NT_PAP_TUTase 245..364 CDD:143392
T08B2.4NP_491797.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.