DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tailor and F43E2.1

DIOPT Version :9

Sequence 1:NP_001262327.1 Gene:Tailor / 40847 FlyBaseID:FBgn0037470 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_495546.2 Gene:F43E2.1 / 185708 WormBaseID:WBGene00018390 Length:467 Species:Caenorhabditis elegans


Alignment Length:182 Identity:49/182 - (26%)
Similarity:78/182 - (42%) Gaps:34/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 KLLSPGFPKQPLRVYKFGSRITGIGNRSSDLDLFVDIGKSGNTFHTFEHRASNATVAKLRAM-RK 312
            :|.|.|...:.|.|  |||..|...::.|||||.|....:||        .....|..|:|: |.
 Worm    70 QLASQGIKLRGLSV--FGSFPTHCASKDSDLDLCVCATATGN--------KKQLPVIILQAIFRD 124

  Fly   313 FFCDSEDWRL--------INFIEQARVPII--KTCHLPTGIECDICLNSMGFCNTNL-LKYI--- 363
            .....|...:        |:|::.|:||||  |...:|..:......|.    .|:| .|||   
 Worm   125 MMYSKEGQNIFGENVVSGISFVQTAKVPIIRFKINDVPVDLSATFDDNP----RTSLAAKYINAY 185

  Fly   364 FESQPLTQYMCIYVKNWLERCKLTEQ-----ISTYSITLMVIYFLQLQALLP 410
            .:.....:.:.:::|.|::.....|.     .::|||.|::|:.||...:||
 Worm   186 CQLDDRFKILVMFLKKWMKSEGRAEDHLRIYPNSYSIILLLIHVLQWYDILP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TailorNP_001262327.1 DUF1439 <70..126 CDD:297551
NT_PAP_TUTase 245..364 CDD:143392 37/129 (29%)
F43E2.1NP_495546.2 NT_PAP_TUTase 51..186 CDD:143392 37/129 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.