DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tailor and C53A5.17

DIOPT Version :9

Sequence 1:	NP_001262327.1	Gene:	Tailor / 40847	FlyBaseID:	FBgn0037470	Length:	563	Species:	Drosophila melanogaster
Sequence 2:	NP_001256592.1	Gene:	C53A5.17 / 13216595	WormBaseID:	WBGene00194707	Length:	474	Species:	Caenorhabditis elegans

Alignment Length:	138	Identity:	26/138 - (18%)
Similarity:	46/138 - (33%)	Gaps:	41/138 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   272 IGNRSSDLDLFVDIGKSGNTFHTF--EHRASNATVAKLRAMRKFFCDSE---DWRLIN----FIE 327
            ||::...|...||..|.|..:..|  :....:.|..|:..:.|....:|   ||..::    |..
Worm    61 IGHKLKPLKNLVDSEKDGKKYLVFHPDKVQEDETRFKILELLKRELGNEKLLDWTTLSKDLTFEN 125

  Fly   328 QARVPIIKTCHLPTGIE--------------------------CDICLNSMGFCNT-----NLLK 361
            .....|.|.. ||.||:                          .::.|:.:..|.|     |::.
Worm   126 WDAKSIFKAV-LPVGIDYSSYTQTGHIIHCNFADEILPFRFIIAEVLLDKVNNCKTVVQKGNIIT 189

  Fly   362 YIFESQPL 369
            .::.:..|
Worm   190 NVYRNLDL 197

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tailor	NP_001262327.1	DUF1439	<70..126	CDD:297551
Tailor	NP_001262327.1	NT_PAP_TUTase	245..364	CDD:143392	25/131 (19%)
C53A5.17	NP_001256592.1	Met_10	144..363	CDD:280612	5/54 (9%)
C53A5.17	NP_001256592.1	AdoMet_MTases	268..>311	CDD:302624
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5260
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900