DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpck and ATCOAE

DIOPT Version :9

Sequence 1:NP_649692.2 Gene:Dpck / 40846 FlyBaseID:FBgn0037469 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001324075.1 Gene:ATCOAE / 817294 AraportID:AT2G27490 Length:232 Species:Arabidopsis thaliana


Alignment Length:233 Identity:98/233 - (42%)
Similarity:146/233 - (62%) Gaps:10/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIVAVTGGIATGKSTISKVFERQGIPVIDADKIAREIVEPGQPCWRQIREVFGDEVLLPSKEIN 65
            |.||.:|||||:||||:|.:|:..||||:|||.:||::::.|...|:::...||:|:||||.|::
plant     1 MRIVGLTGGIASGKSTVSNLFKASGIPVVDADVVARDVLKKGSGGWKRVVAAFGEEILLPSGEVD 65

  Fly    66 RAVLGKMIFEDKELRGKLNKITHPTIHRKIFWQVCKLLVTGHAWIVLDLPLLFETGVLMD-FIHK 129
            |..||:::|.....|..|||:..|.|...|||::.|...:|...||:|:|||||  |.|| :...
plant    66 RPKLGQIVFSSDSKRQLLNKLMAPYISSGIFWEILKQWASGAKVIVVDIPLLFE--VKMDKWTKP 128

  Fly   130 IVCVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKKCEKSHFVIDNNGSVEEAESSAMSIYN 194
            ||.|....:.||:||:.|:.|||.:||:||.:|||||.|..|:..|||||||:::.......:..
plant   129 IVVVWVSQETQLKRLMERDGLSEEDARNRVMAQMPLDSKRSKADVVIDNNGSLDDLHQQFEKVLI 193

  Fly   195 LMRDSK---QHWLNR---ISFLGLFLIVGFTIYMLLKV 226
            .:|...   :.|.:|   .|.|| .:|:|.::...||:
plant   194 EIRRPLTWIEFWRSRQGAFSVLG-SVILGLSVCKQLKI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DpckNP_649692.2 DPCK 3..184 CDD:238980 87/181 (48%)
ATCOAENP_001324075.1 PLN02422 1..232 CDD:215232 98/233 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 166 1.000 Domainoid score I1206
eggNOG 1 0.900 - - E1_COG0237
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5652
Inparanoid 1 1.050 168 1.000 Inparanoid score I1564
OMA 1 1.010 - - QHG62494
OrthoDB 1 1.010 - - D1263008at2759
OrthoFinder 1 1.000 - - FOG0003608
OrthoInspector 1 1.000 - - oto3142
orthoMCL 1 0.900 - - OOG6_101308
Panther 1 1.100 - - LDO PTHR10695
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2483
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.