DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpck and Coasy

DIOPT Version :9

Sequence 1:NP_649692.2 Gene:Dpck / 40846 FlyBaseID:FBgn0037469 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001292911.1 Gene:Coasy / 71743 MGIID:1918993 Length:563 Species:Mus musculus


Alignment Length:235 Identity:56/235 - (23%)
Similarity:106/235 - (45%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIVAVTGGIATGKSTISKVFERQGIPVIDADKIAREIVEPGQPCWRQIREVFGDEVLLPSKEIN 65
            ::::.:||...:|||::::..:..|..:||:|.:......||.|.::.:.|.||.::|.....||
Mouse   357 LYVLGLTGISGSGKSSVAQRLKNLGAYIIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGTIN 421

  Fly    66 RAVLGKMIFEDKELRGKLNKITHPTIHRKIFWQVCKLLVTGHAWIVLDLPLLFETGVLMDFIHKI 130
            |.|||..:|.:|:....|..|..|.|.:....::...:..|....|:|..:|.|.| ....:|::
Mouse   422 RKVLGSRVFGNKKQMKILTDIVWPVIAKLAREEMDVAVAKGKTLCVIDAAMLLEAG-WQSMVHEV 485

  Fly   131 VCVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKKCEKSHFVIDNNGSVEEAESSAMSIYNL 195
            ..|.....:.:.|::.|:.|||:.|:.|:.|||...:..|:|:.|:.........:|.....:||
Mouse   486 WTVVIPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSNVVLSTLWESHVTQSQVEKAWNL 550

  Fly   196 MRDSKQHWLNRISFLGLFLIVGFTIYMLLKVFNRLPESWQ 235
            ::                              .|||:::|
Mouse   551 LQ------------------------------KRLPKAYQ 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DpckNP_649692.2 DPCK 3..184 CDD:238980 49/180 (27%)
CoasyNP_001292911.1 Phosphopantetheine adenylyltransferase 179..357 56/235 (24%)
PPAT_CoAS 192..338 CDD:173915
CoaE 358..557 CDD:223315 54/229 (24%)
DPCK 359..535 CDD:238980 49/176 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.