DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpck and Coasy

DIOPT Version :9

Sequence 1:NP_649692.2 Gene:Dpck / 40846 FlyBaseID:FBgn0037469 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001006955.1 Gene:Coasy / 287711 RGDID:1549767 Length:563 Species:Rattus norvegicus


Alignment Length:176 Identity:49/176 - (27%)
Similarity:93/176 - (52%) Gaps:1/176 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIVAVTGGIATGKSTISKVFERQGIPVIDADKIAREIVEPGQPCWRQIREVFGDEVLLPSKEIN 65
            ::::.:||...:|||::::..:..|..:||:|.:......||.|.::.:.|.||.::|.....||
  Rat   357 IYVLGLTGISGSGKSSVAQRLKNLGAYIIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHQDGTIN 421

  Fly    66 RAVLGKMIFEDKELRGKLNKITHPTIHRKIFWQVCKLLVTGHAWIVLDLPLLFETGVLMDFIHKI 130
            |.|||..:|.:|:....|..|..|.|.:....::...:..|....|:|..:|.|.| ..:.:|::
  Rat   422 RKVLGSRVFGNKKQLKMLTDIVWPVIAKLAREEMDVAVAKGKTLCVIDAAMLLEAG-WQNMVHEV 485

  Fly   131 VCVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKKCEKSHFVI 176
            ..|.....:.:.|::.|:.|||:.|:.|:.:||...:..|:||.|:
  Rat   486 WTVVIPESEAVRRIVERDGLSEAAAQSRLQNQMSGQQLVEQSHVVL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DpckNP_649692.2 DPCK 3..184 CDD:238980 49/174 (28%)
CoasyNP_001006955.1 PPAT_CoAS 192..338 CDD:173915
DPCK 359..535 CDD:238980 49/174 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0237
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.