DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpck and coasy

DIOPT Version :9

Sequence 1:NP_649692.2 Gene:Dpck / 40846 FlyBaseID:FBgn0037469 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_002942317.1 Gene:coasy / 100490454 XenbaseID:XB-GENE-996485 Length:557 Species:Xenopus tropicalis


Alignment Length:196 Identity:55/196 - (28%)
Similarity:98/196 - (50%) Gaps:1/196 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIVAVTGGIATGKSTISKVFERQGIPVIDADKIAREIVEPGQPCWRQIREVFGDEVLLPSKEINR 66
            :::.:|||..:|||:|:|..|..|..|||.||:..:...||.|.:.|:...||.::|.|...|:|
 Frog   343 YVIGLTGGSGSGKSSIAKRLEDLGAAVIDCDKLGHQCYMPGGPAYEQVINEFGSDILCPDGTIDR 407

  Fly    67 AVLGKMIFEDKELRGKLNKITHPTIHRKIFWQVCKLLVTGHAWIVLDLPLLFETGVLMDFIHKIV 131
            ..:|..:|.|||...||..|..|.|.......:.:....|.:..|||..:|.|.| ....:|::.
 Frog   408 KAMGSKVFTDKEQLKKLTDIVWPAIAMLAKKTMEEAASQGISVCVLDAAVLLEAG-WNSMVHEVW 471

  Fly   132 CVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKKCEKSHFVIDNNGSVEEAESSAMSIYNLM 196
            .|.....:.:.|::.|:.:||.:|:.|:.:||...::.:.|..|:......:..:......::|:
 Frog   472 TVIIPEKEAVTRVMGRDGISEEQAKKRLANQMSSSQRVQLSDVVLCTIWEPDVTQKQVQKAWDLL 536

  Fly   197 R 197
            :
 Frog   537 Q 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DpckNP_649692.2 DPCK 3..184 CDD:238980 54/180 (30%)
coasyXP_002942317.1 PPAT_CoAS 178..323 CDD:173915
DPCK 344..518 CDD:238980 54/174 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.