DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1943 and JPT2

DIOPT Version :10

Sequence 1:NP_649691.1 Gene:CG1943 / 40844 FlyBaseID:FBgn0037468 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001421593.1 Gene:JPT2 / 90861 HGNCID:14137 Length:232 Species:Homo sapiens


Alignment Length:102 Identity:30/102 - (29%)
Similarity:39/102 - (38%) Gaps:41/102 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQNSSNLNACMGSTDPNKVVEKIREEVSIQKEE 80
            |..|.:|||||..:|:|..|:.|.|:.|                   ||::...|          
Human    40 PLQRAMKPPGGESSNLFGSPEEATPSSR-------------------PNRMASNI---------- 75

  Fly    81 AKSAPPSQPKEPANKPAATNGEARGRVPPGGFSSGGF 117
               ..|::  ||.|.|..||       ||||..||.|
Human    76 ---FGPTE--EPQNIPKRTN-------PPGGKGSGIF 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1943NP_649691.1 None
JPT2NP_001421593.1 JUPITER 42..>76 CDD:293659 15/65 (23%)

Return to query results.
Submit another query.