DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1943 and Jpt2

DIOPT Version :10

Sequence 1:NP_649691.1 Gene:CG1943 / 40844 FlyBaseID:FBgn0037468 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_945175.1 Gene:Jpt2 / 52009 MGIID:1196260 Length:190 Species:Mus musculus


Alignment Length:105 Identity:27/105 - (25%)
Similarity:39/105 - (37%) Gaps:41/105 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQNSSNLNACMGSTDPNKVVEKIREEVSIQ 77
            :.:..||.:|||||..:::|..|:..:                   .|:.||::...|       
Mouse     9 AGKSGSRSMKPPGGESSDLFGSPEEGI-------------------SSSKPNRMASNI------- 47

  Fly    78 KEEAKSAPPSQPKEPANKPAATNGEARGRVPPGGFSSGGF 117
                 ..|..:||   |.|..||       ||||..||.|
Mouse    48 -----FGPTEEPK---NIPKRTN-------PPGGKGSGIF 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1943NP_649691.1 None
Jpt2NP_945175.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..190 27/105 (26%)
JUPITER 10..>104 CDD:293659 27/104 (26%)

Return to query results.
Submit another query.