DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1943 and JPT1

DIOPT Version :9

Sequence 1:NP_001262326.1 Gene:CG1943 / 40844 FlyBaseID:FBgn0037468 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001002032.1 Gene:JPT1 / 51155 HGNCID:14569 Length:181 Species:Homo sapiens


Alignment Length:121 Identity:37/121 - (30%)
Similarity:53/121 - (43%) Gaps:30/121 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSTELKIGLTTSARPSSRVLKPPGGGHTNI---FSEPDVAVPAPRAKYNQQNSSNLNACMGSTD 62
            ||:|....|:..::|.|||||:||||| :|.   |.|| ...|..:.|.    :||:   .|:.:
Human     1 MTTTTTFKGVDPNSRNSSRVLRPPGGG-SNFSLGFDEP-TEQPVRKNKM----ASNI---FGTPE 56

  Fly    63 PNKVVEKIREEVSIQKEE-AKSAPPSQPKEPANKPAATNGEARGRVPPGGFSSGGF 117
            .|        :.|..|.. |||:...:..|.:......:.||         |||.|
Human    57 EN--------QASWAKSAGAKSSGGREDLESSGLQRRNSSEA---------SSGDF 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1943NP_001262326.1 XRN_N <41..>92 CDD:251765 10/51 (20%)
JPT1NP_001002032.1 JUPITER 1..>58 CDD:293659 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34930
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.