| Sequence 1: | NP_001262326.1 | Gene: | CG1943 / 40844 | FlyBaseID: | FBgn0037468 | Length: | 118 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_731599.1 | Gene: | Jupiter / 41392 | FlyBaseID: | FBgn0051363 | Length: | 208 | Species: | Drosophila melanogaster |
| Alignment Length: | 206 | Identity: | 37/206 - (17%) |
|---|---|---|---|
| Similarity: | 53/206 - (25%) | Gaps: | 102/206 - (49%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 IGLTTSARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQNSSNLNACMGSTDPNKVVEKIRE 72
Fly 73 ---------------EVSIQKEEAKSAPPSQPKEP-------------------ANKPAATNGEA 103
Fly 104 RG-------------------------------------------------------------RV 107
Fly 108 PPGGFSSGGFW 118 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1943 | NP_001262326.1 | XRN_N | <41..>92 | CDD:251765 | 10/65 (15%) |
| Jupiter | NP_731599.1 | JUPITER | 1..208 | CDD:293659 | 36/204 (18%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1620782at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR34930 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X4211 | |
| 3 | 3.110 | |||||