DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1943 and jpt1b

DIOPT Version :9

Sequence 1:NP_001262326.1 Gene:CG1943 / 40844 FlyBaseID:FBgn0037468 Length:118 Species:Drosophila melanogaster
Sequence 2:XP_005163766.1 Gene:jpt1b / 402906 ZFINID:ZDB-GENE-030131-2784 Length:158 Species:Danio rerio


Alignment Length:175 Identity:45/175 - (25%)
Similarity:60/175 - (34%) Gaps:82/175 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSTELKIGLTTSARPSSRVLKPPGGGH------------------TNIFSEPD----------- 36
            ||:|....|:...|:.|||||:||||..                  ::||:|||           
Zfish     1 MTTTTTFQGMEPGAKNSSRVLRPPGGASNISFGTEEEKPVRKNKMASSIFAEPDDPHAHRRNNPP 65

  Fly    37 ----------------------------VAVPAP----RAKYNQQNSSNLNACMGSTDPNKVVEK 69
                                        ...|.|    ..:|.|:|.       |.:|...|   
Zfish    66 GGEASGVLCGEPSAPLRRCQPAIVYDEGAGEPQPNHEDHHEYEQENH-------GESDFPPV--- 120

  Fly    70 IREEVSIQKEEAKSAPPSQPKEPANKPAATNGEARGRVPPGGFSS 114
              ||...|||::.||        :.:|:|.|...| |.||||.||
Zfish   121 --EECVEQKEDSSSA--------SAQPSAGNASGR-RNPPGGKSS 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1943NP_001262326.1 XRN_N <41..>92 CDD:251765 14/54 (26%)
jpt1bXP_005163766.1 JUPITER 14..>97 CDD:293659 15/82 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34930
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.