DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1943 and Jpt2

DIOPT Version :9

Sequence 1:NP_001262326.1 Gene:CG1943 / 40844 FlyBaseID:FBgn0037468 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001013200.1 Gene:Jpt2 / 360492 RGDID:1305117 Length:190 Species:Rattus norvegicus


Alignment Length:105 Identity:28/105 - (26%)
Similarity:39/105 - (37%) Gaps:41/105 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQQNSSNLNACMGSTDPNKVVEKIREEVSIQ 77
            :::...|.:|||||...:||..|:..||                   |:.|:::...|       
  Rat     9 ASKSGFRSMKPPGGESNDIFGSPEEGVP-------------------SSKPHRMASNI------- 47

  Fly    78 KEEAKSAPPSQPKEPANKPAATNGEARGRVPPGGFSSGGF 117
                 ..|..:||   |.|..||       ||||..||.|
  Rat    48 -----FGPTEEPK---NIPKRTN-------PPGGKGSGIF 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1943NP_001262326.1 XRN_N <41..>92 CDD:251765 6/50 (12%)
Jpt2NP_001013200.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 28/105 (27%)
JUPITER 10..>104 CDD:293659 28/104 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..190
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1620782at2759
OrthoFinder 1 1.000 - - FOG0007420
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34930
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4211
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
55.070

Return to query results.
Submit another query.