DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1943 and Jpt1

DIOPT Version :9

Sequence 1:NP_001262326.1 Gene:CG1943 / 40844 FlyBaseID:FBgn0037468 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001005876.1 Gene:Jpt1 / 287828 RGDID:1359325 Length:149 Species:Rattus norvegicus


Alignment Length:152 Identity:41/152 - (26%)
Similarity:61/152 - (40%) Gaps:45/152 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSTELKIGLTTSARPSSRVLKPPGGGH--------------------TNIFSEPDVAVPA---- 41
            ||:|....|:..::|.|||||:|||||.                    :|||..|:...|:    
  Rat     1 MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENPPSWAKS 65

  Fly    42 ------------PRAKYNQQNSSNLNACMGSTDPNKVVEKIREEVSIQKEE--AKSAPPSQPKEP 92
                        .|:..::.:|.:.....|.:|.::.|:...:....|.||  ..:||...|..|
  Rat    66 AGGREDSESPGTQRSNSSEASSGDFLDLKGESDVHENVDTDFQASLAQVEEKPVPAAPVPSPVAP 130

  Fly    93 ANKPAATNGEARGRVPPGGFSS 114
            |..|:..|       ||||.||
  Rat   131 APAPSRRN-------PPGGKSS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1943NP_001262326.1 XRN_N <41..>92 CDD:251765 11/68 (16%)
Jpt1NP_001005876.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..149 41/152 (27%)
JUPITER 1..>58 CDD:293659 19/56 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34930
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.