DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1943 and jpt2

DIOPT Version :9

Sequence 1:NP_001262326.1 Gene:CG1943 / 40844 FlyBaseID:FBgn0037468 Length:118 Species:Drosophila melanogaster
Sequence 2:XP_012825626.1 Gene:jpt2 / 100216034 XenbaseID:XB-GENE-971048 Length:192 Species:Xenopus tropicalis


Alignment Length:193 Identity:54/193 - (27%)
Similarity:74/193 - (38%) Gaps:76/193 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTSTELKIGLTTSARPSSRVLKPPGGGHTNIFSEPDVAVPAPRAKYNQ----------------- 48
            ||||....||.:.::||||||||||||.:.|||..| ..|||...:..                 
 Frog     1 MTSTHSFQGLDSESKPSSRVLKPPGGGSSCIFSGSD-ETPAPSRSHKMASNIFGSQAEPENMSKR 64

  Fly    49 ------------------QNSSNLNACMG-----------STDPNKVVEKIREEVSIQKEEA--- 81
                              |.:|.:|...|           :|.|.....|.::.::|.:.:|   
 Frog    65 SNPPGGKPSGIFQEPDPVQAASRVNPPGGKGSNIFGEAKLTTSPKAHPNKPKDNINIFETDASKG 129

  Fly    82 ----KSAP-PSQPKE---PANK--------PAATNGE--------ARGRV--PPGGFSSGGFW 118
                |:|| |::|:|   |..|        ||....|        :..||  ||||.||..|:
 Frog   130 STPVKAAPSPAKPQEQKIPVAKEEKVVVPDPALAAHEPHLGPRPRSHNRVLNPPGGKSSVTFY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1943NP_001262326.1 XRN_N <41..>92 CDD:251765 17/107 (16%)
jpt2XP_012825626.1 JUPITER 10..188 CDD:293659 46/178 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5289
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1620782at2759
OrthoFinder 1 1.000 - - FOG0007420
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4211
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.