DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ufl1 and rtraf

DIOPT Version :9

Sequence 1:NP_001246957.1 Gene:Ufl1 / 40843 FlyBaseID:FBgn0037467 Length:782 Species:Drosophila melanogaster
Sequence 2:XP_002936950.1 Gene:rtraf / 100493394 XenbaseID:XB-GENE-973282 Length:240 Species:Xenopus tropicalis


Alignment Length:96 Identity:23/96 - (23%)
Similarity:44/96 - (45%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   587 ICNELSLYVASECNLTVKNTNLNVDQRNKLAQECEAQYRAALLEQNKALNKSIDDFELATETVLK 651
            :.|.|.:....:..:.:|...:.|.:|  |:||..|:..::......||:|.|..|:.. :.||.
 Frog   133 LANLLQIQKHDDYLMMLKGIRILVQER--LSQEAVAKSNSSKEGLPVALDKHILGFDTG-DAVLN 194

  Fly   652 TCSMIIKKVDKKKDRLLIADHKKKLQKQLLE 682
            ..:.|:        |||..:..::||.::.|
 Frog   195 DAARIL--------RLLHIEELRELQTKINE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ufl1NP_001246957.1 DUF2042 7..271 CDD:286786
rtrafXP_002936950.1 RLL 5..239 CDD:370789 23/96 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165177694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.