DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment djl and dj

DIOPT Version :9

Sequence 1:NP_649686.2 Gene:djl / 40839 FlyBaseID:FBgn0037463 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_731118.3 Gene:dj / 40838 FlyBaseID:FBgn0019828 Length:248 Species:Drosophila melanogaster


Alignment Length:281 Identity:135/281 - (48%)
Similarity:181/281 - (64%) Gaps:35/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKRPALVY-RCLQTSVKRSYHLNAHEHLRKKEILKPESQPSQKHKKFGDGSIGVIHVIKNEYYG 64
            |.||.||:. ||.|.:..|.:|:|..|:.::.:.|     |:|...||.|.|   ||..::....
  Fly     1 MFKRTALILRRCFQPTFIRPHHINVLENFKEADDL-----PNQGQAKFVDVS---IHDPQHIRSA 57

  Fly    65 LPNPMHRKFREDLEKHQDRRKESNLSLKEEKREDLEKMLKECQKLVKEITMQANDGDVTKICKEL 129
            |.:||.|||.:|||:.|..|.:   ..||..:::||.|..||::|..||.|.|..||:.|.||||
  Fly    58 LVSPMQRKFLQDLEQQQTVRIK---WFKEGNQDELENMKNECRRLALEIIMAAKGGDIKKACKEL 119

  Fly   130 AQKEKMDKEKIKKKCRELAAREKCEKDKLKKKCKKLLKKDKCKKKDTCEEEKPCEEEDPCEKKS- 193
            |:|                  |||::.:||||||:|.||.||.|||.|:::.||:::|||:||. 
  Fly   120 AEK------------------EKCKQIELKKKCKELEKKTKCAKKDPCKKKDPCKKKDPCKKKDP 166

  Fly   194 CCPKDPCAKKPKKVDPCKKKDPCKKEDPCKKKAVNWKKKCKEVAEREQCKKLAEKKKFKKMIKIC 258
            |..||||.||    |||||||||||:||||||..:.|||||::||:|:|||||:|:|.||:.|.|
  Fly   167 CKKKDPCKKK----DPCKKKDPCKKKDPCKKKGGDLKKKCKKLAEKEKCKKLAKKEKMKKLQKKC 227

  Fly   259 KNLAAKEKCKKMAEKEMCRKK 279
            |.:|.||||||||:|:.|:||
  Fly   228 KKMAQKEKCKKMAKKDKCKKK 248



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.