DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dj and djl

DIOPT Version :9

Sequence 1:NP_731118.3 Gene:dj / 40838 FlyBaseID:FBgn0019828 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_649686.2 Gene:djl / 40839 FlyBaseID:FBgn0037463 Length:286 Species:Drosophila melanogaster


Alignment Length:281 Identity:135/281 - (48%)
Similarity:181/281 - (64%) Gaps:35/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKRTALILRRCFQPTFIRPHHINVLENFKEADDL-----PNQGQAKFVDVS---IHDPQHIRSA 57
            |.||.||:. ||.|.:..|.:|:|..|:.::.:.|     |:|...||.|.|   ||..::....
  Fly     1 MLKRPALVY-RCLQTSVKRSYHLNAHEHLRKKEILKPESQPSQKHKKFGDGSIGVIHVIKNEYYG 64

  Fly    58 LVSPMQRKFLQDLEQQQTVRIK---WFKEGNQDELENMKNECRRLALEIIMAAKGGDIKKACKEL 119
            |.:||.|||.:|||:.|..|.:   ..||..:::||.|..||::|..||.|.|..||:.|.||||
  Fly    65 LPNPMHRKFREDLEKHQDRRKESNLSLKEEKREDLEKMLKECQKLVKEITMQANDGDVTKICKEL 129

  Fly   120 AEK------------------EKCKQIELKKKCKELEKKTKCAKKDPCKKKDPCKKKDPCKKKDP 166
            |:|                  |||::.:||||||:|.||.||.|||.|:::.||:::|||:||. 
  Fly   130 AQKEKMDKEKIKKKCRELAAREKCEKDKLKKKCKKLLKKDKCKKKDTCEEEKPCEEEDPCEKKS- 193

  Fly   167 CKKKDPCKKK----DPCKKKDPCKKKDPCKKKGGDLKKKCKKLAEKEKCKKLAKKEKMKKLQKKC 227
            |..||||.||    |||||||||||:||||||..:.|||||::||:|:|||||:|:|.||:.|.|
  Fly   194 CCPKDPCAKKPKKVDPCKKKDPCKKEDPCKKKAVNWKKKCKEVAEREQCKKLAEKKKFKKMIKIC 258

  Fly   228 KKMAQKEKCKKMAKKDKCKKK 248
            |.:|.||||||||:|:.|:||
  Fly   259 KNLAAKEKCKKMAEKEMCRKK 279



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019384
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.