DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-1 and YNL134C

DIOPT Version :9

Sequence 1:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_014265.3 Gene:YNL134C / 855588 SGDID:S000005078 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:379 Identity:79/379 - (20%)
Similarity:139/379 - (36%) Gaps:119/379 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVL-TKPMIIGHESAGVVAKLGKKVTTLK-- 83
            ||||:.:..||:  .:|.:.|:...:    :..||.: .:..::|.::||.:.|||..|...:  
Yeast    26 PIPELEEGFVLI--KTVAVAGNPTDW----KHIDFKIGPQGALLGCDAAGQIVKLGPNVDAARFA 84

  Fly    84 VGDRVAIEPGVPCRKCDHCKQGKYNLCPGMVFCATP--PYDGNLTRY--------YKHAADFCF- 137
            :||.:.                      |::..|:.  |.:|....|        ||.|.:|.. 
Yeast    85 IGDYIY----------------------GVIHGASVRFPSNGAFAEYSAISSETAYKPAREFRLC 127

  Fly   138 ---KLPD-HVTMEEGALLEPLSVGVHACKRAEVTLGSKVLILGAGPIGL-VTLMAAQAMGASEIL 197
               |||: .|...|||:..|:|:         .|.|   :|| ....|| :|...::|.....||
Yeast   128 GKDKLPEGPVKSLEGAVSLPVSL---------TTAG---MIL-THSFGLDMTWKPSKAQRDQPIL 179

  Fly   198 I----TDLVQQRLDVAKELGATHTLLLKRDQTAEETAVLVQKTMGGQPDKSIDCCGAESSARLAI 258
            .    |.:.|..:.:||:|.....:::...:..|:    :.|..|.  |:..|...|:       
Yeast   180 FWGGATAVGQMLIQLAKKLNGFSKIIVVASRKHEK----LLKEYGA--DELFDYHDAD------- 231

  Fly   259 FATRSGGIVVVVGMGAAEIKLP-LINALAREVDIRGVFRYCNDYAAALALVASGKVNVKRLVTHH 322
                     |:..:......:| |::.::....|:.|::...|...|..        |:..|...
Yeast   232 ---------VIEQIKKKYNNIPYLVDCVSNTETIQQVYKCAADDLDATV--------VQLTVLTE 279

  Fly   323 FDIKETAKAFETSRKG-----LGG-------------------AIKVMIHVQPR 352
            .||||..:....|.:|     :||                   |||.:..:.|:
Yeast   280 KDIKEEDRRQNVSIEGTLLYLIGGNDVPFGTFTLPADPEYKEAAIKFIKFINPK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 78/371 (21%)
sorbitol_DH 8..349 CDD:176188 78/374 (21%)
YNL134CNP_014265.3 enoyl_reductase_like 9..375 CDD:176211 79/379 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.