DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sodh-1 and AST1

DIOPT Version :9

Sequence 1:NP_001287203.1 Gene:Sodh-1 / 40836 FlyBaseID:FBgn0024289 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_009484.2 Gene:AST1 / 852209 SGDID:S000000165 Length:429 Species:Saccharomyces cerevisiae


Alignment Length:432 Identity:85/432 - (19%)
Similarity:152/432 - (35%) Gaps:157/432 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GIEDMRLEQR---PIPEIADDEVLLAMDSVGICGSDVH----YLA--HGRIGDFVLTKPMIIGHE 67
            |..|...|::   |||:   :::::.:.:||:...|:.    |.:  :|.||         :|.|
Yeast    60 GPMDFSYEKKIKTPIPK---NKIVVRVSNVGLNPVDMKIRNGYTSSIYGEIG---------LGRE 112

  Fly    68 SAGVVAKLGKKVT-TLKVGDRVAIEPGVPCRKCDHCKQGKYNLCPGMVFCATPPYDGNLTRYYKH 131
            .:||:.::|:.:. ...|||.|               .|.|                    |:.|
Yeast   113 YSGVITEVGENLNYAWHVGDEV---------------YGIY--------------------YHPH 142

  Fly   132 AADFCFK--------------LPDHVTMEEGA-----------LLEPLSVGVHACKRAEVTLGSK 171
            .|..|.:              .|:.|:.||.|           :|..||      |...:...|.
Yeast   143 LAVGCLQSSILVDPKVDPILLRPESVSAEEAAGSLFCLATGYNILNKLS------KNKYLKQDSN 201

  Fly   172 VLIL-GAGPIGLVTL--------------MAAQAMG-----------ASEILITDLVQQRLDVAK 210
            |||. |...:|:..:              :...|.|           |.|::..|.:..|...:|
Yeast   202 VLINGGTSSVGMFVIQLLKRHYKLQKKLVIVTSANGPQVLQEKFPDLADEMIFIDYLTCRGKSSK 266

  Fly   211 ELGATHTLLLKRDQTAEETAVLVQKTM----GGQPDKSIDCCG-----AESSARLAIFATRSGGI 266
            .|    ..:|:..:.::...|..::|:    .|:.|..:|..|     :.||:.:    ...|..
Yeast   267 PL----RKMLEEKKISQYDPVEDKETILNYNEGKFDVVLDFVGGYDILSHSSSLI----HGGGAY 323

  Fly   267 VVVVGMGAAEIKLPLI------NALAREV--DIRGVFRYCNDYAAALALVASGKVN--------- 314
            |..||...|..|..:.      :|.||::  .|...:.|.:.|....|..||...:         
Yeast   324 VTTVGDYVANYKEDIFDSWDNPSANARKMFGSIIWSYNYTHYYFDPNAKTASANNDWIEQCGDFL 388

  Fly   315 ----VKRLVTHHFDIKETAKAFE--TSRKGLGGAIKVMIHVQ 350
                ||.:|...:|.|:..:||.  .:::..|   |::::|:
Yeast   389 KNGTVKCVVDKVYDWKDHKEAFSYMATQRAQG---KLIMNVE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sodh-1NP_001287203.1 PLN02702 4..346 CDD:215378 84/426 (20%)
sorbitol_DH 8..349 CDD:176188 84/429 (20%)
AST1NP_009484.2 AST1_like 50..426 CDD:176209 84/429 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.